happy new year 2026 rustic snow globe sneeuwbol (Achterkant)happy new year 2026 rustic snow globe sneeuwbol (Zijkant)happy new year 2026 rustic snow globe sneeuwbol (Kerstmis)
happy new year 2026 rustic snow globe sneeuwbol (Voorkant)
€ 16,20
per sneeuwbol
 

happy new year 2026 rustic snow globe sneeuwbol

Bekijk productdetails

Andere designs in deze categorie

Over Snow Globes

Aangeboden door

Stijl: Koepel Sneeuwbol

Fotokristallen zijn een leuke en unieke manier om je favoriete herinneringen te tonen, waardoor ze het perfecte cadeau zijn voor vrienden en familie. Er is iets heel bijzonders aan een gepersonaliseerd cadeau dat met liefde is gemaakt.

  • Afmetingen bol: 8,4 cm (L) × 8,4 cm (H)
  • Afmetingen interne afbeelding: 6 cm (L) × 7 cm (H)
  • Acrylbol en basis
  • Aanpasbare print aan twee zijden
  • Dit is geen speelgoed. Aanbevolen voor 14 jaar en ouder
  • Elke bol bevat in totaal ca. 180ml water, waardoor deze NIET voldoet aan TSA-regels voor handbagage.

Over dit ontwerp

happy new year 2026 rustic snow globe sneeuwbol

happy new year 2026 rustic snow globe sneeuwbol

This wreath motif would look charming inside a new year snow globe 2025. The glitter crystal new year globe feeling appears when you imagine it with snow. It can become a happy new year keepsake gift for nature lovers. The elegant new year snow ball mood matches the pinecones and stars. People enjoy a winter holiday collectible globe that feels peaceful. Overall it turns into a luxury new year gift globe with rustic style.

Klant beoordelingen

Er zijn nog geen reviews voor dit product.Heb je dit product gekocht?

Tags

Snow Globes
newyearsnowglobe2025glittercrystalnewyearglobehappynewyearkeepsakegiftelegantnewyearsnowballwinterholidaycollectibleglobeluxurynewyeargiftglobestylishholidaydeskdecorblackgoldsnowglobedecorpremiumsnowglobesouvenirglowingnewyearsnowglobe
Alle producten:
newyearsnowglobe2025glittercrystalnewyearglobehappynewyearkeepsakegiftelegantnewyearsnowballwinterholidaycollectibleglobeluxurynewyeargiftglobestylishholidaydeskdecorblackgoldsnowglobedecorpremiumsnowglobesouvenirglowingnewyearsnowglobe

Andere Info

Product ID: 256442318044430840
Ontworpen op: 21-11-2025 23:57
Rating: G